Sermorelin

Price range: S$299.00 through S$689.00

Sermorelin is GHRH(1-29) amide, the shortest fully active fragment of growth hormone releasing hormone, used in GHRH receptor research.

Formula: C149H246N44O42S
MW: 3357.9
CAS: 86168-78-7

Ships in 1–2 business days · free shipping

Option

Clear

Questions?

Purity is >99% (manufacturer's HPLC specification). Batch documentation is available on request — message @north_vial before you order.

For laboratory research use only. Not for human or animal consumption. Not approved by the HSA for therapeutic use.

SKU: N/A Category: Growth Hormone Axis

Description
Specifications

Description

Sermorelin corresponds to the first 29 amino acids of human growth hormone releasing hormone, amidated at the C-terminus. This fragment was identified as the shortest sequence retaining the full biological activity of the 44-residue native hormone.

As a well-characterised GHRH-receptor agonist, sermorelin is used to study pituitary somatotroph function, cAMP-dependent signalling and the feedback relationships between GHRH, somatostatin and growth hormone. Its short half-life makes it a natural comparator for longer-acting analogues such as CJC-1295, and it has been used in animal research on the regulation of growth hormone secretion. It is also a common reference peptide in assays that compare GHRH analogues for receptor potency and enzymatic stability.

Keep vials sealed and cold until use.

For use by qualified researchers in a laboratory setting only. Not intended for human or veterinary use of any kind.

Supplied as a 10-vial kit of lyophilised powder. Dispatched in 1–2 business days.

CAS number	`86168-78-7`
Molecular formula	`C149H246N44O42S`
Molecular weight	`3357.9 g/mol`
Sequence	`YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2`
Purity	>99% (manufacturer's HPLC specification). Batch documentation on request.
Form	Lyophilised powder
Pack	10 vials per kit
Storage	Store at 2–8 °C, protected from direct sunlight and moisture. For long-term storage, −20 °C.
Intended use	Laboratory research only. Not for human or animal consumption.

Product FAQ

What is Sermorelin?

Sermorelin is GHRH(1-29) amide, the shortest fully active fragment of growth hormone releasing hormone, used in GHRH receptor research.

What does a Sermorelin kit contain and what does it cost?

Sermorelin is sold as a kit of 10 vials of lyophilised (freeze-dried) powder, in 2 mg, 5 mg, 10 mg per vial. Prices run from S$299 to S$689 per 10-vial kit, with free shipping.

What are the CAS number and molecular formula of Sermorelin?

Sermorelin has CAS number 86168-78-7, molecular formula C149H246N44O42S, molecular weight 3357.9 g/mol.

How should Sermorelin be stored?

Store the sealed vials at 2–8 °C, protected from direct sunlight and moisture; for long-term storage, −20 °C is standard practice. Once reconstituted, keep refrigerated and use within the period appropriate to the compound.

What purity is Sermorelin?

Purity is >99% (manufacturer's HPLC specification). Batch documentation is available on request — message @north_vial before you order.

Is Sermorelin for human or animal use?

No. Sermorelin is supplied strictly as a laboratory reference material for in-vitro research use only — not for human or animal consumption, and not approved for therapeutic use.

How fast does Sermorelin ship and how do I pay?

Shipping is free. Orders are dispatched in 1–2 business days and usually delivered in 6–9 business days. Payment is by cryptocurrency: Bitcoin (BTC), or USDT/USDC/ETH on the Ethereum (ERC-20) network.